PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G50570.1
Common NameMBA10.13, SPL13, SPL13A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 359aa    MW: 39108.4 Da    PI: 7.9385
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G50570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322e-41100177178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +C v+gC++d+s+++eyh+rhkvC+vhsk+pvv+++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  AT5G50570.1 100 ICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEFDEGKRSCRKRLDGHNRRRRKPQP 177
                  5**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.6E-3394162IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.91598175IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3999180IPR004333Transcription factor, SBP-box
PfamPF031103.7E-30101174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MDWNFKLSSG YLSGFDQEPD LSPMDGSISF GGSSQSKADF SFDLKLGRNI GNSSSVFGDT  60
EQVISLSKWK DSALAKPEGS RSSSSKRTRG NGVGTNQMPI CLVDGCDSDF SNCREYHKRH  120
KVCDVHSKTP VVTINGHKQR FCQQCSRFHA LEEFDEGKRS CRKRLDGHNR RRRKPQPEHI  180
GRPANFFTGF QGSKLLEFSG GSHVFPTTSV LNPSWGNSLV SVAVAANGSS YGQSQSYVVG  240
SSPAKTGIMF PISSSPNSTR SIAKQFPFLQ EEESSRTASL CERMTSCIHD SDCALSLLSS  300
SSSSVPHLLQ PPLSLSQEAV ETVFYGSGLF ENASAVSDGS VISGNEAVRL PQTFPFHWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2894174484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157174KRSCRKRLDGHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.297200.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453620370.0
Genevisible248524_s_at0.0
Expression AtlasAT5G50570-
AtGenExpressAT5G50570-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Weak increase of expression during floral induction. {ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G50570.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G50570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174750.0AK117475.1 Arabidopsis thaliana At5g50670 mRNA for unknown protein, complete cds, clone: RAFL17-08-M12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568731.10.0squamosa promoter-binding-like protein 13
RefseqNP_568740.10.0squamosa promoter-binding-like protein 13
RefseqNP_851161.10.0squamosa promoter-binding-like protein 13
SwissprotB9DI200.0SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI110.0SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLD7MQ980.0D7MQ98_ARALL; Putative uncharacterized protein
STRINGAT5G50570.10.0(Arabidopsis thaliana)
STRINGAT5G50670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Representative plantOGRP9717230
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  4. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  5. DeCook R,Lall S,Nettleton D,Howell SH
    Genetic regulation of gene expression during shoot development in Arabidopsis.
    Genetics, 2006. 172(2): p. 1155-64
    [PMID:15956669]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Brodersen P, et al.
    Arabidopsis MAP kinase 4 regulates salicylic acid- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4.
    Plant J., 2006. 47(4): p. 532-46
    [PMID:16813576]
  8. Lobbes D,Rallapalli G,Schmidt DD,Martin C,Clarke J
    SERRATE: a new player on the plant microRNA scene.
    EMBO Rep., 2006. 7(10): p. 1052-8
    [PMID:16977334]
  9. Gandikota M, et al.
    The miRNA156/157 recognition element in the 3' UTR of the Arabidopsis SBP box gene SPL3 prevents early flowering by translational inhibition in seedlings.
    Plant J., 2007. 49(4): p. 683-93
    [PMID:17217458]
  10. Guo AY, et al.
    Genome-wide identification and evolutionary analysis of the plant specific SBP-box transcription factor family.
    Gene, 2008. 418(1-2): p. 1-8
    [PMID:18495384]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Xing S,Salinas M,H
    miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis.
    Plant Cell, 2010. 22(12): p. 3935-50
    [PMID:21177480]